Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,280
  2. Avatar for Go Science 2. Go Science 73 pts. 10,258
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,251
  4. Avatar for Contenders 4. Contenders 36 pts. 10,221
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 10,217
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,202
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 10,198
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,197
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,167
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,797
  1. Avatar for crpainter 11. crpainter Lv 1 72 pts. 10,221
  2. Avatar for Neil9 12. Neil9 Lv 1 70 pts. 10,217
  3. Avatar for guineapig 13. guineapig Lv 1 67 pts. 10,206
  4. Avatar for retiredmichael 14. retiredmichael Lv 1 65 pts. 10,206
  5. Avatar for nicobul 15. nicobul Lv 1 63 pts. 10,202
  6. Avatar for Galaxie 16. Galaxie Lv 1 60 pts. 10,201
  7. Avatar for jausmh 17. jausmh Lv 1 58 pts. 10,198
  8. Avatar for pauldunn 18. pauldunn Lv 1 56 pts. 10,198
  9. Avatar for frood66 19. frood66 Lv 1 54 pts. 10,197
  10. Avatar for joremen 20. joremen Lv 1 52 pts. 10,190

Comments