Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,280
  2. Avatar for Go Science 2. Go Science 73 pts. 10,258
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,251
  4. Avatar for Contenders 4. Contenders 36 pts. 10,221
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 10,217
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,202
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 10,198
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,197
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,167
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,797

  1. Avatar for atlas100 71. atlas100 Lv 1 5 pts. 9,915
  2. Avatar for froggs554 72. froggs554 Lv 1 5 pts. 9,913
  3. Avatar for severin333 73. severin333 Lv 1 5 pts. 9,900
  4. Avatar for frostschutz 74. frostschutz Lv 1 5 pts. 9,900
  5. Avatar for stomjoh 75. stomjoh Lv 1 4 pts. 9,893
  6. Avatar for Arne Heessels 76. Arne Heessels Lv 1 4 pts. 9,891
  7. Avatar for tarimo 77. tarimo Lv 1 4 pts. 9,879
  8. Avatar for Deleted player 78. Deleted player pts. 9,876
  9. Avatar for mitarcher 79. mitarcher Lv 1 3 pts. 9,872
  10. Avatar for ourtown 80. ourtown Lv 1 3 pts. 9,870

Comments