Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for freefolder 11. freefolder 2 pts. 9,986
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,770
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,758
  4. Avatar for 7Monkeys 15. 7Monkeys 1 pt. 9,689
  5. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,211
  6. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,117
  7. Avatar for BCC 19. BCC 1 pt. 8,216

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,751
  2. Avatar for LociOiling 2. LociOiling Lv 1 82 pts. 10,745
  3. Avatar for bertro 3. bertro Lv 1 66 pts. 10,745
  4. Avatar for smilingone 4. smilingone Lv 1 53 pts. 10,742
  5. Avatar for robgee 5. robgee Lv 1 42 pts. 10,738
  6. Avatar for reefyrob 6. reefyrob Lv 1 33 pts. 10,735
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 26 pts. 10,730
  8. Avatar for toshiue 8. toshiue Lv 1 20 pts. 10,730
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 15 pts. 10,728
  10. Avatar for mirp 10. mirp Lv 1 11 pts. 10,720

Comments