Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for freefolder 11. freefolder 2 pts. 9,986
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,770
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,758
  4. Avatar for 7Monkeys 15. 7Monkeys 1 pt. 9,689
  5. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,211
  6. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,117
  7. Avatar for BCC 19. BCC 1 pt. 8,216

  1. Avatar for bertro
    1. bertro Lv 1
    100 pts. 10,749
  2. Avatar for mirp 2. mirp Lv 1 97 pts. 10,727
  3. Avatar for reefyrob 3. reefyrob Lv 1 94 pts. 10,717
  4. Avatar for Deleted player 4. Deleted player pts. 10,714
  5. Avatar for Galaxie 5. Galaxie Lv 1 88 pts. 10,708
  6. Avatar for johnmitch 6. johnmitch Lv 1 85 pts. 10,682
  7. Avatar for Aubade01 7. Aubade01 Lv 1 82 pts. 10,671
  8. Avatar for LociOiling 8. LociOiling Lv 1 79 pts. 10,665
  9. Avatar for crpainter 9. crpainter Lv 1 77 pts. 10,652
  10. Avatar for Timo van der Laan 10. Timo van der Laan Lv 1 74 pts. 10,650

Comments