Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for freefolder 11. freefolder 2 pts. 9,986
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,770
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,758
  4. Avatar for 7Monkeys 15. 7Monkeys 1 pt. 9,689
  5. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,211
  6. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,117
  7. Avatar for BCC 19. BCC 1 pt. 8,216

  1. Avatar for Knoblerine 121. Knoblerine Lv 1 1 pt. 9,222
  2. Avatar for tscherulli 122. tscherulli Lv 1 1 pt. 9,217
  3. Avatar for aspadistra 123. aspadistra Lv 1 1 pt. 9,211
  4. Avatar for NotJim99 124. NotJim99 Lv 1 1 pt. 9,208
  5. Avatar for mirjamvandelft 125. mirjamvandelft Lv 1 1 pt. 9,168
  6. Avatar for doctaven 126. doctaven Lv 1 1 pt. 9,117
  7. Avatar for Anamfija 127. Anamfija Lv 1 1 pt. 9,078
  8. Avatar for parsnip 128. parsnip Lv 1 1 pt. 9,069
  9. Avatar for Katabolanga 129. Katabolanga Lv 1 1 pt. 9,054
  10. Avatar for Wendy.L 130. Wendy.L Lv 1 1 pt. 9,016

Comments