Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for freefolder 11. freefolder 2 pts. 9,986
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,770
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,758
  4. Avatar for Team Schleswig-Holstein 14. Team Schleswig-Holstein 1 pt. 9,695
  5. Avatar for 7Monkeys 15. 7Monkeys 1 pt. 9,689
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 9,550
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,211
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,117
  9. Avatar for BCC 19. BCC 1 pt. 8,216
  1. Avatar for wozzarelli 131. wozzarelli Lv 1 1 pt. 8,999
  2. Avatar for leehaggis 132. leehaggis Lv 1 1 pt. 8,989
  3. Avatar for Zapdos 133. Zapdos Lv 1 1 pt. 8,970
  4. Avatar for TisWielki 134. TisWielki Lv 1 1 pt. 8,919
  5. Avatar for may of rose 135. may of rose Lv 1 1 pt. 8,861
  6. Avatar for Mao Mao 136. Mao Mao Lv 1 1 pt. 8,853
  7. Avatar for AustinGeorge 137. AustinGeorge Lv 1 1 pt. 8,849
  8. Avatar for Pavel1940 138. Pavel1940 Lv 1 1 pt. 8,826
  9. Avatar for RufusDelta 139. RufusDelta Lv 1 1 pt. 8,812
  10. Avatar for 01010011111 140. 01010011111 Lv 1 1 pt. 8,732

Comments