Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for freefolder 11. freefolder 2 pts. 9,986
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,770
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,758
  4. Avatar for 7Monkeys 15. 7Monkeys 1 pt. 9,689
  5. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,211
  6. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,117
  7. Avatar for BCC 19. BCC 1 pt. 8,216

  1. Avatar for retiredmichael 11. retiredmichael Lv 1 71 pts. 10,630
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 69 pts. 10,606
  3. Avatar for smilingone 13. smilingone Lv 1 67 pts. 10,569
  4. Avatar for pauldunn 14. pauldunn Lv 1 64 pts. 10,529
  5. Avatar for Flagg65a 15. Flagg65a Lv 1 62 pts. 10,525
  6. Avatar for YeshuaLives 16. YeshuaLives Lv 1 60 pts. 10,525
  7. Avatar for Crossed Sticks 17. Crossed Sticks Lv 1 58 pts. 10,510
  8. Avatar for frood66 18. frood66 Lv 1 56 pts. 10,507
  9. Avatar for actiasluna 19. actiasluna Lv 1 54 pts. 10,507
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 52 pts. 10,484

Comments