Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for freefolder 11. freefolder 2 pts. 9,986
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,770
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,758
  4. Avatar for Team Schleswig-Holstein 14. Team Schleswig-Holstein 1 pt. 9,695
  5. Avatar for 7Monkeys 15. 7Monkeys 1 pt. 9,689
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 9,550
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,211
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,117
  9. Avatar for BCC 19. BCC 1 pt. 8,216
  1. Avatar for manu8170 51. manu8170 Lv 1 14 pts. 10,293
  2. Avatar for katling 52. katling Lv 1 13 pts. 10,267
  3. Avatar for carsonfb 53. carsonfb Lv 1 13 pts. 10,264
  4. Avatar for jobo0502 54. jobo0502 Lv 1 12 pts. 10,244
  5. Avatar for MicElephant 55. MicElephant Lv 1 11 pts. 10,215
  6. Avatar for pvc78 56. pvc78 Lv 1 11 pts. 10,198
  7. Avatar for Deleted player 57. Deleted player pts. 10,183
  8. Avatar for Vinara 58. Vinara Lv 1 10 pts. 10,175
  9. Avatar for Steven Pletsch 59. Steven Pletsch Lv 1 9 pts. 10,145
  10. Avatar for cbwest 60. cbwest Lv 1 9 pts. 10,144

Comments