Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for freefolder 11. freefolder 2 pts. 9,986
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,770
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,758
  4. Avatar for Team Schleswig-Holstein 14. Team Schleswig-Holstein 1 pt. 9,695
  5. Avatar for 7Monkeys 15. 7Monkeys 1 pt. 9,689
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 9,550
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,211
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,117
  9. Avatar for BCC 19. BCC 1 pt. 8,216
  1. Avatar for petetrig 81. petetrig Lv 1 3 pts. 9,926
  2. Avatar for rezaefar 82. rezaefar Lv 1 3 pts. 9,918
  3. Avatar for joaniegirl 83. joaniegirl Lv 1 2 pts. 9,906
  4. Avatar for ViJay7019 84. ViJay7019 Lv 1 2 pts. 9,900
  5. Avatar for kludbrook 85. kludbrook Lv 1 2 pts. 9,890
  6. Avatar for MarkinM 86. MarkinM Lv 1 2 pts. 9,867
  7. Avatar for Glen B 87. Glen B Lv 1 2 pts. 9,862
  8. Avatar for justintwayland 88. justintwayland Lv 1 2 pts. 9,859
  9. Avatar for Psych0Active 89. Psych0Active Lv 1 2 pts. 9,850
  10. Avatar for Petrifolder 90. Petrifolder Lv 1 2 pts. 9,835

Comments