Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,751
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,749
  3. Avatar for Go Science 3. Go Science 56 pts. 10,730
  4. Avatar for Contenders 4. Contenders 41 pts. 10,652
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 10,650
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 10,507
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,507
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 10,484
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 10,423
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 10,075

  1. Avatar for lamoille 11. lamoille Lv 1 8 pts. 10,719
  2. Avatar for phi16 12. phi16 Lv 1 6 pts. 10,716
  3. Avatar for Deleted player 13. Deleted player pts. 10,714
  4. Avatar for retiredmichael 14. retiredmichael Lv 1 3 pts. 10,712
  5. Avatar for sciencewalker 15. sciencewalker Lv 1 2 pts. 10,701
  6. Avatar for Hollinas 16. Hollinas Lv 1 2 pts. 10,555
  7. Avatar for jausmh 17. jausmh Lv 1 1 pt. 10,507
  8. Avatar for dbuske 18. dbuske Lv 1 1 pt. 10,494
  9. Avatar for TastyMunchies 19. TastyMunchies Lv 1 1 pt. 10,403
  10. Avatar for ViJay7019 20. ViJay7019 Lv 1 1 pt. 10,388

Comments