1529: Revisiting Puzzle 68: Bos Taurus
Closed since almost 8 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- June 03, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ