Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,751
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,749
  3. Avatar for Go Science 3. Go Science 56 pts. 10,730
  4. Avatar for Contenders 4. Contenders 41 pts. 10,652
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 10,650
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 10,507
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,507
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 10,484
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 10,423
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 10,075

  1. Avatar for crazyman4865 101. crazyman4865 Lv 1 1 pt. 9,674
  2. Avatar for momadoc 102. momadoc Lv 1 1 pt. 9,673
  3. Avatar for navn 103. navn Lv 1 1 pt. 9,658
  4. Avatar for baiyuncanggou 104. baiyuncanggou Lv 1 1 pt. 9,625
  5. Avatar for TheStaticSloth 105. TheStaticSloth Lv 1 1 pt. 9,620
  6. Avatar for rabamino12358 106. rabamino12358 Lv 1 1 pt. 9,619
  7. Avatar for ManVsYard 107. ManVsYard Lv 1 1 pt. 9,573
  8. Avatar for nathanmills 108. nathanmills Lv 1 1 pt. 9,550
  9. Avatar for west.elsdon 109. west.elsdon Lv 1 1 pt. 9,539
  10. Avatar for drjr 110. drjr Lv 1 1 pt. 9,531

Comments