Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,751
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,749
  3. Avatar for Go Science 3. Go Science 56 pts. 10,730
  4. Avatar for Contenders 4. Contenders 41 pts. 10,652
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 10,650
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 10,507
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,507
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 10,484
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 10,423
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 10,075

  1. Avatar for wozzarelli 131. wozzarelli Lv 1 1 pt. 8,999
  2. Avatar for leehaggis 132. leehaggis Lv 1 1 pt. 8,989
  3. Avatar for Zapdos 133. Zapdos Lv 1 1 pt. 8,970
  4. Avatar for TisWielki 134. TisWielki Lv 1 1 pt. 8,919
  5. Avatar for may of rose 135. may of rose Lv 1 1 pt. 8,861
  6. Avatar for Mao Mao 136. Mao Mao Lv 1 1 pt. 8,853
  7. Avatar for AustinGeorge 137. AustinGeorge Lv 1 1 pt. 8,849
  8. Avatar for Pavel1940 138. Pavel1940 Lv 1 1 pt. 8,826
  9. Avatar for RufusDelta 139. RufusDelta Lv 1 1 pt. 8,812
  10. Avatar for 01010011111 140. 01010011111 Lv 1 1 pt. 8,732

Comments