Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,751
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,749
  3. Avatar for Go Science 3. Go Science 56 pts. 10,730
  4. Avatar for Contenders 4. Contenders 41 pts. 10,652
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 10,650
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 10,507
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,507
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 10,484
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 10,423
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 10,075

  1. Avatar for retiredmichael 11. retiredmichael Lv 1 71 pts. 10,630
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 69 pts. 10,606
  3. Avatar for smilingone 13. smilingone Lv 1 67 pts. 10,569
  4. Avatar for pauldunn 14. pauldunn Lv 1 64 pts. 10,529
  5. Avatar for Flagg65a 15. Flagg65a Lv 1 62 pts. 10,525
  6. Avatar for YeshuaLives 16. YeshuaLives Lv 1 60 pts. 10,525
  7. Avatar for Crossed Sticks 17. Crossed Sticks Lv 1 58 pts. 10,510
  8. Avatar for frood66 18. frood66 Lv 1 56 pts. 10,507
  9. Avatar for actiasluna 19. actiasluna Lv 1 54 pts. 10,507
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 52 pts. 10,484

Comments