Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,751
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,749
  3. Avatar for Go Science 3. Go Science 56 pts. 10,730
  4. Avatar for Contenders 4. Contenders 41 pts. 10,652
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 10,650
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 10,507
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,507
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 10,484
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 10,423
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 10,075
  1. Avatar for Voltozan 141. Voltozan Lv 1 1 pt. 8,243
  2. Avatar for frezae 142. frezae Lv 1 1 pt. 8,216
  3. Avatar for joshmiller 143. joshmiller Lv 1 1 pt. 8,179
  4. Avatar for Siino8 144. Siino8 Lv 1 1 pt. 8,116
  5. Avatar for citric acid 145. citric acid Lv 1 1 pt. 7,973
  6. Avatar for larry25427 146. larry25427 Lv 1 1 pt. 7,103
  7. Avatar for Sophia Maldonado 147. Sophia Maldonado Lv 1 1 pt. 5,731
  8. Avatar for Rymbek 148. Rymbek Lv 1 1 pt. 4,888
  9. Avatar for zaruvne 149. zaruvne Lv 1 1 pt. 4,859
  10. Avatar for Felix12356 150. Felix12356 Lv 1 1 pt. 4,858

Comments