Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since over 7 years ago

Intermediate Pilot

Summary


Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,133
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 7,813
  3. Avatar for Team South Africa 14. Team South Africa 1 pt. 5,684

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,196
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 76 pts. 10,196
  3. Avatar for Galaxie 3. Galaxie Lv 1 56 pts. 10,186
  4. Avatar for LociOiling 4. LociOiling Lv 1 41 pts. 10,181
  5. Avatar for smilingone 5. smilingone Lv 1 29 pts. 10,179
  6. Avatar for tyler0911 6. tyler0911 Lv 1 20 pts. 10,161
  7. Avatar for robgee 7. robgee Lv 1 14 pts. 10,156
  8. Avatar for alwen 8. alwen Lv 1 9 pts. 10,149
  9. Avatar for Hollinas 9. Hollinas Lv 1 6 pts. 10,105
  10. Avatar for toshiue 10. toshiue Lv 1 4 pts. 10,080

Comments