Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since over 7 years ago

Intermediate Pilot

Summary

Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,133
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 7,813
  3. Avatar for Team Schleswig-Holstein 13. Team Schleswig-Holstein 1 pt. 7,778
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 5,684
  1. Avatar for aspadistra 91. aspadistra Lv 1 1 pt. 7,813
  2. Avatar for Bithalbierer 92. Bithalbierer Lv 1 1 pt. 7,778
  3. Avatar for atlas100 93. atlas100 Lv 1 1 pt. 7,753
  4. Avatar for ourtown 94. ourtown Lv 1 1 pt. 7,743
  5. Avatar for Singam 95. Singam Lv 1 1 pt. 7,700
  6. Avatar for NotJim99 96. NotJim99 Lv 1 1 pt. 7,684
  7. Avatar for antibot215 97. antibot215 Lv 1 1 pt. 7,683
  8. Avatar for RNakamurase 98. RNakamurase Lv 1 1 pt. 7,485
  9. Avatar for Arne Heessels 99. Arne Heessels Lv 1 1 pt. 7,481
  10. Avatar for yoyoparis 100. yoyoparis Lv 1 1 pt. 7,469

Comments