Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Pilot Pilot Pilot Pilot Pilot Pilot

Summary


Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,133
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 7,813
  3. Avatar for Team South Africa 14. Team South Africa 1 pt. 5,684

  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 39 pts. 9,648
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 37 pts. 9,583
  3. Avatar for O Seki To 23. O Seki To Lv 1 35 pts. 9,563
  4. Avatar for jobo0502 24. jobo0502 Lv 1 34 pts. 9,490
  5. Avatar for isaksson 25. isaksson Lv 1 32 pts. 9,487
  6. Avatar for MicElephant 26. MicElephant Lv 1 30 pts. 9,469
  7. Avatar for alcor29 27. alcor29 Lv 1 29 pts. 9,433
  8. Avatar for YeshuaLives 28. YeshuaLives Lv 1 27 pts. 9,414
  9. Avatar for pauldunn 29. pauldunn Lv 1 26 pts. 9,389
  10. Avatar for alwen 30. alwen Lv 1 24 pts. 9,360

Comments