Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since over 7 years ago

Intermediate Pilot

Summary


Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,133
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 7,813
  3. Avatar for Team South Africa 14. Team South Africa 1 pt. 5,684

  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 23 pts. 9,344
  2. Avatar for georg137 32. georg137 Lv 1 22 pts. 9,338
  3. Avatar for joaniegirl 33. joaniegirl Lv 1 20 pts. 9,267
  4. Avatar for sciencewalker 34. sciencewalker Lv 1 19 pts. 9,229
  5. Avatar for Merf 35. Merf Lv 1 18 pts. 9,226
  6. Avatar for Jesse Pinkman 36. Jesse Pinkman Lv 1 17 pts. 9,220
  7. Avatar for smilingone 37. smilingone Lv 1 16 pts. 9,211
  8. Avatar for NinjaGreg 38. NinjaGreg Lv 1 15 pts. 9,205
  9. Avatar for DoctorSockrates 39. DoctorSockrates Lv 1 14 pts. 9,167
  10. Avatar for johnmitch 40. johnmitch Lv 1 13 pts. 9,153

Comments