Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Pilot

Summary


Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,133
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 7,813
  3. Avatar for Team South Africa 14. Team South Africa 1 pt. 5,684

  1. Avatar for jausmh 81. jausmh Lv 1 1 pt. 8,411
  2. Avatar for lconor 82. lconor Lv 1 1 pt. 8,377
  3. Avatar for TastyMunchies 83. TastyMunchies Lv 1 1 pt. 8,366
  4. Avatar for paulcianci 84. paulcianci Lv 1 1 pt. 8,323
  5. Avatar for phi16 85. phi16 Lv 1 1 pt. 8,274
  6. Avatar for JasperD 86. JasperD Lv 1 1 pt. 8,133
  7. Avatar for martinf 87. martinf Lv 1 1 pt. 8,041
  8. Avatar for boondog 88. boondog Lv 1 1 pt. 7,944
  9. Avatar for nakanoelio 89. nakanoelio Lv 1 1 pt. 7,932
  10. Avatar for matosfran 90. matosfran Lv 1 1 pt. 7,929

Comments