Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Pilot Pilot

Summary


Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Void Crushers 100 pts. 10,405
  2. Avatar for Go Science 2. Go Science 68 pts. 10,199
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,196
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,195
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,180
  6. Avatar for Contenders 6. Contenders 9 pts. 9,867
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,648
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,563
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,061
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,662

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 10,481
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 96 pts. 10,405
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 92 pts. 10,199
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 88 pts. 10,196
  5. Avatar for robgee 5. robgee Lv 1 84 pts. 10,195
  6. Avatar for LociOiling 6. LociOiling Lv 1 81 pts. 10,194
  7. Avatar for frood66 7. frood66 Lv 1 77 pts. 10,180
  8. Avatar for tarimo 8. tarimo Lv 1 74 pts. 10,091
  9. Avatar for tyler0911 9. tyler0911 Lv 1 70 pts. 10,083
  10. Avatar for mirp 10. mirp Lv 1 67 pts. 10,082

Comments