Placeholder image of a protein
Icon representing a puzzle

1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin

Closed since over 7 years ago

Intermediate Pilot

Summary

Created
July 03, 2018
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.



This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 10,405
  2. Avatar for Go Science 2. Go Science 68 pts. 10,199
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,196
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,195
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,180
  6. Avatar for Contenders 6. Contenders 9 pts. 9,867
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,648
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,563
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,061
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,662
  1. Avatar for katling 111. katling Lv 1 1 pt. 6,057
  2. Avatar for Jrv211624 112. Jrv211624 Lv 1 1 pt. 5,825
  3. Avatar for doctaven 113. doctaven Lv 1 1 pt. 5,684
  4. Avatar for 01010011111 114. 01010011111 Lv 1 1 pt. 0
  5. Avatar for Jiessie 115. Jiessie Lv 1 1 pt. 0
  6. Avatar for Anton_K 116. Anton_K Lv 1 1 pt. 0
  7. Avatar for Deleted player 117. Deleted player pts. 0

Comments