Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot

Summary


Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,064
  2. Avatar for BCC 12. BCC 1 pt. 10,540
  3. Avatar for Team South Africa 14. Team South Africa 1 pt. 10,152
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,928

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,660
  2. Avatar for bertro 2. bertro Lv 1 81 pts. 11,656
  3. Avatar for dbuske 3. dbuske Lv 1 65 pts. 11,626
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 52 pts. 11,619
  5. Avatar for reefyrob 5. reefyrob Lv 1 41 pts. 11,618
  6. Avatar for toshiue 6. toshiue Lv 1 32 pts. 11,617
  7. Avatar for mirp 7. mirp Lv 1 24 pts. 11,617
  8. Avatar for Galaxie 8. Galaxie Lv 1 18 pts. 11,592
  9. Avatar for robgee 9. robgee Lv 1 14 pts. 11,591
  10. Avatar for smilingone 10. smilingone Lv 1 10 pts. 11,577

Comments