1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7
Closed since over 7 years ago
Intermediate PilotSummary
- Created
- July 09, 2018
- Expires
- Max points
- 100
This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
Top groups
Comments