Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since over 7 years ago

Intermediate Pilot

Summary


Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,064
  2. Avatar for BCC 12. BCC 1 pt. 10,540
  3. Avatar for Team South Africa 14. Team South Africa 1 pt. 10,152
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,928

  1. Avatar for Deleted player 61. Deleted player pts. 10,702
  2. Avatar for Alistair69 62. Alistair69 Lv 1 5 pts. 10,695
  3. Avatar for LavenderSky 63. LavenderSky Lv 1 4 pts. 10,641
  4. Avatar for Kevonni 64. Kevonni Lv 1 4 pts. 10,637
  5. Avatar for frostschutz 65. frostschutz Lv 1 4 pts. 10,575
  6. Avatar for rezaefar 66. rezaefar Lv 1 4 pts. 10,574
  7. Avatar for Vinara 67. Vinara Lv 1 3 pts. 10,562
  8. Avatar for katiekt94 68. katiekt94 Lv 1 3 pts. 10,544
  9. Avatar for frezae 69. frezae Lv 1 3 pts. 10,540
  10. Avatar for Deleted player 70. Deleted player pts. 10,533

Comments