Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since over 7 years ago

Intermediate Pilot

Summary

Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,660
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,652
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,621
  4. Avatar for Go Science 4. Go Science 30 pts. 11,619
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,619
  6. Avatar for Contenders 6. Contenders 11 pts. 11,527
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,510
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,435
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 11,230
  10. Avatar for Minions of TWIS 10. Minions of TWIS 1 pt. 11,126
  1. Avatar for phi16 11. phi16 Lv 1 7 pts. 11,561
  2. Avatar for alcor29 12. alcor29 Lv 1 5 pts. 11,551
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 4 pts. 11,551
  4. Avatar for alwen 14. alwen Lv 1 3 pts. 11,551
  5. Avatar for TastyMunchies 15. TastyMunchies Lv 1 2 pts. 11,520
  6. Avatar for jausmh 16. jausmh Lv 1 1 pt. 11,433
  7. Avatar for JMStiffler 17. JMStiffler Lv 1 1 pt. 11,416
  8. Avatar for Deleted player 18. Deleted player pts. 11,351
  9. Avatar for isaksson 19. isaksson Lv 1 1 pt. 11,310
  10. Avatar for Vincera 20. Vincera Lv 1 1 pt. 11,291

Comments