Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Pilot Pilot Pilot

Summary


Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Beta Folders 100 pts. 11,660
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,652
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,621
  4. Avatar for Go Science 4. Go Science 30 pts. 11,619
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,619
  6. Avatar for Contenders 6. Contenders 11 pts. 11,527
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,510
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,435
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 11,230
  10. Avatar for Minions of TWIS 10. Minions of TWIS 1 pt. 11,126

  1. Avatar for alyssajoyh 91. alyssajoyh Lv 1 1 pt. 10,226
  2. Avatar for JMStiffler 92. JMStiffler Lv 1 1 pt. 10,217
  3. Avatar for rabamino12358 93. rabamino12358 Lv 1 1 pt. 10,197
  4. Avatar for cobaltteal 94. cobaltteal Lv 1 1 pt. 10,186
  5. Avatar for Might-o-chondria 95. Might-o-chondria Lv 1 1 pt. 10,172
  6. Avatar for atlas100 96. atlas100 Lv 1 1 pt. 10,164
  7. Avatar for doctaven 97. doctaven Lv 1 1 pt. 10,152
  8. Avatar for ourtown 98. ourtown Lv 1 1 pt. 10,145
  9. Avatar for YeshuaLives 99. YeshuaLives Lv 1 1 pt. 10,138
  10. Avatar for momadoc 100. momadoc Lv 1 1 pt. 10,134

Comments