Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since over 7 years ago

Intermediate Intermediate Pilot Pilot

Summary


Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Beta Folders 100 pts. 11,660
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,652
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,621
  4. Avatar for Go Science 4. Go Science 30 pts. 11,619
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,619
  6. Avatar for Contenders 6. Contenders 11 pts. 11,527
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,510
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,435
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 11,230
  10. Avatar for Minions of TWIS 10. Minions of TWIS 1 pt. 11,126

  1. Avatar for TastyMunchies 11. TastyMunchies Lv 1 67 pts. 11,528
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 65 pts. 11,527
  3. Avatar for Idiotboy 13. Idiotboy Lv 1 62 pts. 11,510
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 59 pts. 11,510
  5. Avatar for eusair 15. eusair Lv 1 57 pts. 11,509
  6. Avatar for pvc78 16. pvc78 Lv 1 54 pts. 11,502
  7. Avatar for fiendish_ghoul 17. fiendish_ghoul Lv 1 52 pts. 11,486
  8. Avatar for hpaege 18. hpaege Lv 1 50 pts. 11,480
  9. Avatar for Galaxie 19. Galaxie Lv 1 48 pts. 11,472
  10. Avatar for katling 20. katling Lv 1 46 pts. 11,446

Comments