Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Intermediate Pilot Pilot

Summary


Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Beta Folders 100 pts. 11,660
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,652
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,621
  4. Avatar for Go Science 4. Go Science 30 pts. 11,619
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,619
  6. Avatar for Contenders 6. Contenders 11 pts. 11,527
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,510
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,435
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 11,230
  10. Avatar for Minions of TWIS 10. Minions of TWIS 1 pt. 11,126

  1. Avatar for ViJay7019 71. ViJay7019 Lv 1 3 pts. 10,482
  2. Avatar for Amsterdamaged 72. Amsterdamaged Lv 1 2 pts. 10,434
  3. Avatar for Superphosphate 73. Superphosphate Lv 1 2 pts. 10,424
  4. Avatar for mitarcher 74. mitarcher Lv 1 2 pts. 10,423
  5. Avatar for MicElephant 75. MicElephant Lv 1 2 pts. 10,417
  6. Avatar for pfirth 76. pfirth Lv 1 2 pts. 10,407
  7. Avatar for rinze 77. rinze Lv 1 2 pts. 10,371
  8. Avatar for Blipperman 78. Blipperman Lv 1 2 pts. 10,370
  9. Avatar for andrewxc 79. andrewxc Lv 1 1 pt. 10,368
  10. Avatar for jobo0502 80. jobo0502 Lv 1 1 pt. 10,360

Comments