Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups



  1. Avatar for Anamfija 101. Anamfija Lv 1 1 pt. 6,429
  2. Avatar for JMStiffler 102. JMStiffler Lv 1 1 pt. 6,363
  3. Avatar for Bithalbierer 103. Bithalbierer Lv 1 1 pt. 6,332
  4. Avatar for antibot215 104. antibot215 Lv 1 1 pt. 6,297
  5. Avatar for PMiglionico 105. PMiglionico Lv 1 1 pt. 6,277
  6. Avatar for drjr 106. drjr Lv 1 1 pt. 6,104
  7. Avatar for Richard Huang 107. Richard Huang Lv 1 1 pt. 5,892
  8. Avatar for froggs554 108. froggs554 Lv 1 1 pt. 4,884
  9. Avatar for 01010011111 109. 01010011111 Lv 1 1 pt. 4,229
  10. Avatar for Gahmeir 110. Gahmeir Lv 1 1 pt. 4,005

Comments