Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups



  1. Avatar for reefyrob 11. reefyrob Lv 1 63 pts. 10,893
  2. Avatar for Idiotboy 12. Idiotboy Lv 1 60 pts. 10,888
  3. Avatar for hpaege 13. hpaege Lv 1 58 pts. 10,863
  4. Avatar for Galaxie 14. Galaxie Lv 1 55 pts. 10,862
  5. Avatar for alcor29 15. alcor29 Lv 1 52 pts. 10,862
  6. Avatar for LociOiling 16. LociOiling Lv 1 50 pts. 10,853
  7. Avatar for sciencewalker 17. sciencewalker Lv 1 47 pts. 10,852
  8. Avatar for O Seki To 18. O Seki To Lv 1 45 pts. 10,830
  9. Avatar for diamonddays 19. diamonddays Lv 1 42 pts. 10,819
  10. Avatar for Alistair69 20. Alistair69 Lv 1 40 pts. 10,782

Comments