Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups



  1. Avatar for Altercomp 21. Altercomp Lv 1 38 pts. 10,760
  2. Avatar for TastyMunchies 22. TastyMunchies Lv 1 36 pts. 10,755
  3. Avatar for retiredmichael 23. retiredmichael Lv 1 34 pts. 10,726
  4. Avatar for Norrjane 24. Norrjane Lv 1 33 pts. 10,659
  5. Avatar for Merf 25. Merf Lv 1 31 pts. 10,652
  6. Avatar for crpainter 26. crpainter Lv 1 29 pts. 10,636
  7. Avatar for eusair 27. eusair Lv 1 28 pts. 10,632
  8. Avatar for silent gene 28. silent gene Lv 1 26 pts. 10,624
  9. Avatar for mirp 29. mirp Lv 1 25 pts. 10,620
  10. Avatar for rezaefar 30. rezaefar Lv 1 23 pts. 10,614

Comments