Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups



  1. Avatar for alwen 31. alwen Lv 1 22 pts. 10,597
  2. Avatar for jobo0502 32. jobo0502 Lv 1 21 pts. 10,589
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 19 pts. 10,559
  4. Avatar for MicElephant 34. MicElephant Lv 1 18 pts. 10,539
  5. Avatar for uihcv 35. uihcv Lv 1 17 pts. 10,498
  6. Avatar for manu8170 36. manu8170 Lv 1 16 pts. 10,471
  7. Avatar for smilingone 37. smilingone Lv 1 15 pts. 10,452
  8. Avatar for cobaltteal 38. cobaltteal Lv 1 14 pts. 10,450
  9. Avatar for ManVsYard 39. ManVsYard Lv 1 13 pts. 10,434
  10. Avatar for NinjaGreg 40. NinjaGreg Lv 1 13 pts. 10,425

Comments