Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups



  1. Avatar for isaksson 41. isaksson Lv 1 12 pts. 10,412
  2. Avatar for johnmitch 42. johnmitch Lv 1 11 pts. 10,395
  3. Avatar for joaniegirl 43. joaniegirl Lv 1 10 pts. 10,381
  4. Avatar for christioanchauvin 44. christioanchauvin Lv 1 10 pts. 10,372
  5. Avatar for Deleted player 45. Deleted player pts. 10,360
  6. Avatar for Crossed Sticks 46. Crossed Sticks Lv 1 8 pts. 10,355
  7. Avatar for jausmh 47. jausmh Lv 1 8 pts. 10,350
  8. Avatar for LavenderSky 48. LavenderSky Lv 1 7 pts. 10,342
  9. Avatar for tarimo 49. tarimo Lv 1 7 pts. 10,313
  10. Avatar for Glen B 50. Glen B Lv 1 6 pts. 10,272

Comments