Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups



  1. Avatar for stomjoh 51. stomjoh Lv 1 6 pts. 10,251
  2. Avatar for katling 52. katling Lv 1 5 pts. 10,234
  3. Avatar for Superphosphate 53. Superphosphate Lv 1 5 pts. 10,230
  4. Avatar for Museka 54. Museka Lv 1 5 pts. 10,226
  5. Avatar for YeshuaLives 55. YeshuaLives Lv 1 4 pts. 10,189
  6. Avatar for ViJay7019 56. ViJay7019 Lv 1 4 pts. 10,187
  7. Avatar for hexidecimalhack 57. hexidecimalhack Lv 1 4 pts. 10,170
  8. Avatar for SouperGenious 58. SouperGenious Lv 1 3 pts. 10,169
  9. Avatar for lconor 59. lconor Lv 1 3 pts. 10,169
  10. Avatar for Deleted player 60. Deleted player pts. 10,160

Comments