Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups



  1. Avatar for cbwest 61. cbwest Lv 1 3 pts. 10,088
  2. Avatar for kludbrook 62. kludbrook Lv 1 3 pts. 10,049
  3. Avatar for izzgood 63. izzgood Lv 1 2 pts. 10,036
  4. Avatar for Mike Cassidy 64. Mike Cassidy Lv 1 2 pts. 9,962
  5. Avatar for mitarcher 65. mitarcher Lv 1 2 pts. 9,873
  6. Avatar for dcrwheeler 66. dcrwheeler Lv 1 2 pts. 9,865
  7. Avatar for nicobul 67. nicobul Lv 1 2 pts. 9,840
  8. Avatar for rinze 68. rinze Lv 1 2 pts. 9,807
  9. Avatar for spdenne 69. spdenne Lv 1 2 pts. 9,784
  10. Avatar for georg137 70. georg137 Lv 1 1 pt. 9,735

Comments