Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups



  1. Avatar for Flagg65a 71. Flagg65a Lv 1 1 pt. 9,727
  2. Avatar for rabamino12358 72. rabamino12358 Lv 1 1 pt. 9,606
  3. Avatar for veroxdraco 73. veroxdraco Lv 1 1 pt. 9,557
  4. Avatar for Vinara 74. Vinara Lv 1 1 pt. 9,553
  5. Avatar for pfirth 75. pfirth Lv 1 1 pt. 9,520
  6. Avatar for alyssajoyh 76. alyssajoyh Lv 1 1 pt. 9,500
  7. Avatar for multaq 77. multaq Lv 1 1 pt. 9,498
  8. Avatar for momadoc 78. momadoc Lv 1 1 pt. 9,494
  9. Avatar for leehaggis 79. leehaggis Lv 1 1 pt. 9,443
  10. Avatar for dbuske 80. dbuske Lv 1 1 pt. 9,436

Comments