Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups



  1. Avatar for Arne Heessels 81. Arne Heessels Lv 1 1 pt. 9,433
  2. Avatar for Scopper 82. Scopper Lv 1 1 pt. 9,416
  3. Avatar for Knoblerine 83. Knoblerine Lv 1 1 pt. 9,365
  4. Avatar for doctaven 84. doctaven Lv 1 1 pt. 9,164
  5. Avatar for Blipperman 85. Blipperman Lv 1 1 pt. 9,163
  6. Avatar for Vincera 86. Vincera Lv 1 1 pt. 9,158
  7. Avatar for Amsterdamaged 88. Amsterdamaged Lv 1 1 pt. 8,810
  8. Avatar for Kevonni 89. Kevonni Lv 1 1 pt. 8,588
  9. Avatar for frostschutz 90. frostschutz Lv 1 1 pt. 7,802

Comments