Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,032
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,009
  3. Avatar for Go Science 3. Go Science 47 pts. 11,003
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,993
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 10,944
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,934
  7. Avatar for Contenders 7. Contenders 7 pts. 10,912
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 10,830
  9. Avatar for freefolder 9. freefolder 2 pts. 10,760
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,676

  1. Avatar for reefyrob 11. reefyrob Lv 1 63 pts. 10,893
  2. Avatar for Idiotboy 12. Idiotboy Lv 1 60 pts. 10,888
  3. Avatar for hpaege 13. hpaege Lv 1 58 pts. 10,863
  4. Avatar for Galaxie 14. Galaxie Lv 1 55 pts. 10,862
  5. Avatar for alcor29 15. alcor29 Lv 1 52 pts. 10,862
  6. Avatar for LociOiling 16. LociOiling Lv 1 50 pts. 10,853
  7. Avatar for sciencewalker 17. sciencewalker Lv 1 47 pts. 10,852
  8. Avatar for O Seki To 18. O Seki To Lv 1 45 pts. 10,830
  9. Avatar for diamonddays 19. diamonddays Lv 1 42 pts. 10,819
  10. Avatar for Alistair69 20. Alistair69 Lv 1 40 pts. 10,782

Comments