1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein
Closed since over 7 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- July 12, 2018
- Expires
- Max points
- 100
This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA
Top groups
-
100 pts. 11,032
-
-
-
-
-
-
-
-
-
Comments