Placeholder image of a protein
Icon representing a puzzle

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 12, 2018
Expires
Max points
100
Description

This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,032
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,009
  3. Avatar for Go Science 3. Go Science 47 pts. 11,003
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,993
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 10,944
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,934
  7. Avatar for Contenders 7. Contenders 7 pts. 10,912
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 10,830
  9. Avatar for freefolder 9. freefolder 2 pts. 10,760
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,676
  1. Avatar for JasperD 91. JasperD Lv 1 1 pt. 7,506
  2. Avatar for Satina 92. Satina Lv 1 1 pt. 7,172
  3. Avatar for phi16 93. phi16 Lv 1 1 pt. 6,903
  4. Avatar for weitzen 94. weitzen Lv 1 1 pt. 6,772
  5. Avatar for parsnip 95. parsnip Lv 1 1 pt. 6,771
  6. Avatar for boondog 96. boondog Lv 1 1 pt. 6,753
  7. Avatar for DipsyDoodle2016 97. DipsyDoodle2016 Lv 1 1 pt. 6,741
  8. Avatar for ourtown 98. ourtown Lv 1 1 pt. 6,659
  9. Avatar for atlas100 99. atlas100 Lv 1 1 pt. 6,549
  10. Avatar for Might-o-chondria 100. Might-o-chondria Lv 1 1 pt. 6,491

Comments