Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups



  1. Avatar for bertro
    1. bertro Lv 1
    100 pts. 10,873
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 10,820
  3. Avatar for frood66 3. frood66 Lv 1 92 pts. 10,766
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 87 pts. 10,756
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 83 pts. 10,738
  6. Avatar for hpaege 6. hpaege Lv 1 80 pts. 10,713
  7. Avatar for Galaxie 7. Galaxie Lv 1 76 pts. 10,638
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 72 pts. 10,635
  9. Avatar for Idiotboy 9. Idiotboy Lv 1 69 pts. 10,628
  10. Avatar for grogar7 10. grogar7 Lv 1 65 pts. 10,578

Comments