Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,889
  2. Avatar for Marvin's bunch 2. Marvin's bunch 63 pts. 10,766
  3. Avatar for Go Science 3. Go Science 37 pts. 10,738
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 10,638
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 10,635
  6. Avatar for Contenders 6. Contenders 5 pts. 10,359
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,143
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 1 pt. 9,992
  9. Avatar for freefolder 9. freefolder 1 pt. 9,380
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,262
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,889
  2. Avatar for reefyrob 2. reefyrob Lv 1 71 pts. 10,865
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 49 pts. 10,847
  4. Avatar for dbuske 4. dbuske Lv 1 33 pts. 10,819
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 22 pts. 10,732
  6. Avatar for jausmh 6. jausmh Lv 1 14 pts. 10,666
  7. Avatar for toshiue 7. toshiue Lv 1 8 pts. 10,663
  8. Avatar for mirp 8. mirp Lv 1 5 pts. 10,646
  9. Avatar for Galaxie 9. Galaxie Lv 1 3 pts. 10,612
  10. Avatar for ViJay7019 10. ViJay7019 Lv 1 2 pts. 10,590

Comments