1556: Revisiting Puzzle 73: Polycystein
Closed since over 7 years ago
Intermediate Overall PredictionSummary
- Created
- August 01, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA
Top groups
-
1. LociOiling Lv 1100 pts. 10,618 -
-
-
-
-
-
-
-
-
Comments
JellyJump Lv 1
The accepted name for this protien is "polycystin 1" not polycystein