Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,618
  2. Avatar for smilingone 2. smilingone Lv 1 76 pts. 10,606
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 56 pts. 10,598
  4. Avatar for reefyrob 4. reefyrob Lv 1 41 pts. 10,549
  5. Avatar for Galaxie 5. Galaxie Lv 1 29 pts. 10,474
  6. Avatar for lamoille 6. lamoille Lv 1 20 pts. 10,466
  7. Avatar for robgee 7. robgee Lv 1 14 pts. 10,461
  8. Avatar for ManVsYard 8. ManVsYard Lv 1 9 pts. 10,446
  9. Avatar for andrewxc 9. andrewxc Lv 1 6 pts. 10,443
  10. Avatar for toshiue 10. toshiue Lv 1 4 pts. 10,435

Comments