Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879
  1. Avatar for Fount 91. Fount Lv 1 1 pt. 8,994
  2. Avatar for Enzyme 92. Enzyme Lv 1 1 pt. 8,973
  3. Avatar for Kevonni 93. Kevonni Lv 1 1 pt. 8,846
  4. Avatar for StarWarsWasOK 94. StarWarsWasOK Lv 1 1 pt. 8,841
  5. Avatar for Auntecedent 95. Auntecedent Lv 1 1 pt. 8,798
  6. Avatar for boondog 96. boondog Lv 1 1 pt. 8,782
  7. Avatar for kludbrook 97. kludbrook Lv 1 1 pt. 8,745
  8. Avatar for Savas 98. Savas Lv 1 1 pt. 8,731
  9. Avatar for rinze 99. rinze Lv 1 1 pt. 8,666
  10. Avatar for Anamfija 100. Anamfija Lv 1 1 pt. 8,662

Comments