Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879

  1. Avatar for paulcianci 111. paulcianci Lv 1 1 pt. 8,270
  2. Avatar for robyred 112. robyred Lv 1 1 pt. 8,248
  3. Avatar for parsnip 113. parsnip Lv 1 1 pt. 8,210
  4. Avatar for larry25427 114. larry25427 Lv 1 1 pt. 8,188
  5. Avatar for idrori 115. idrori Lv 1 1 pt. 8,187
  6. Avatar for Altercomp 116. Altercomp Lv 1 1 pt. 8,163
  7. Avatar for badgoes 117. badgoes Lv 1 1 pt. 8,148
  8. Avatar for sboy171772 118. sboy171772 Lv 1 1 pt. 8,092
  9. Avatar for alyssajoyh 119. alyssajoyh Lv 1 1 pt. 8,010
  10. Avatar for joshmiller 120. joshmiller Lv 1 1 pt. 7,688

Comments