Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879
  1. Avatar for sangramraut 121. sangramraut Lv 1 1 pt. 7,649
  2. Avatar for 01010011111 122. 01010011111 Lv 1 1 pt. 4,879
  3. Avatar for JMStiffler 123. JMStiffler Lv 1 1 pt. 4,879
  4. Avatar for brow42 124. brow42 Lv 1 1 pt. 4,879
  5. Avatar for devjosh 125. devjosh Lv 1 1 pt. 4,879
  6. Avatar for josh00 126. josh00 Lv 1 1 pt. 4,879
  7. Avatar for Hollinas 127. Hollinas Lv 1 1 pt. 4,879
  8. Avatar for test_account1 128. test_account1 Lv 1 1 pt. 4,879

Comments