Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879

  1. Avatar for frood66 11. frood66 Lv 1 67 pts. 10,439
  2. Avatar for Timo van der Laan 12. Timo van der Laan Lv 1 64 pts. 10,411
  3. Avatar for grogar7 13. grogar7 Lv 1 61 pts. 10,409
  4. Avatar for tyler0911 14. tyler0911 Lv 1 59 pts. 10,407
  5. Avatar for pvc78 15. pvc78 Lv 1 56 pts. 10,405
  6. Avatar for crpainter 16. crpainter Lv 1 54 pts. 10,400
  7. Avatar for Bruno Kestemont 17. Bruno Kestemont Lv 1 52 pts. 10,370
  8. Avatar for Crossed Sticks 18. Crossed Sticks Lv 1 49 pts. 10,367
  9. Avatar for johnmitch 19. johnmitch Lv 1 47 pts. 10,365
  10. Avatar for Galaxie 20. Galaxie Lv 1 45 pts. 10,333

Comments