Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879
  1. Avatar for nicobul 21. nicobul Lv 1 43 pts. 10,322
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 41 pts. 10,310
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 39 pts. 10,284
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 37 pts. 10,255
  5. Avatar for NinjaGreg 25. NinjaGreg Lv 1 36 pts. 10,232
  6. Avatar for robgee 26. robgee Lv 1 34 pts. 10,225
  7. Avatar for Vinara 27. Vinara Lv 1 32 pts. 10,213
  8. Avatar for O Seki To 28. O Seki To Lv 1 31 pts. 10,189
  9. Avatar for pauldunn 29. pauldunn Lv 1 29 pts. 10,179
  10. Avatar for smilingone 30. smilingone Lv 1 28 pts. 10,128

Comments