Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879
  1. Avatar for Jesse Pinkman 31. Jesse Pinkman Lv 1 26 pts. 10,126
  2. Avatar for georg137 32. georg137 Lv 1 25 pts. 10,092
  3. Avatar for jausmh 33. jausmh Lv 1 24 pts. 10,087
  4. Avatar for TastyMunchies 34. TastyMunchies Lv 1 23 pts. 10,074
  5. Avatar for tarimo 35. tarimo Lv 1 22 pts. 10,053
  6. Avatar for Glen B 36. Glen B Lv 1 20 pts. 10,023
  7. Avatar for MurloW 37. MurloW Lv 1 19 pts. 9,983
  8. Avatar for cobaltteal 38. cobaltteal Lv 1 18 pts. 9,969
  9. Avatar for fpc 39. fpc Lv 1 17 pts. 9,955
  10. Avatar for sciencewalker 40. sciencewalker Lv 1 16 pts. 9,916

Comments